Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VEGFA (Human) Recombinant ProteinBioActive

  • Catalog # : P3673
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VEGFA (P15692, 27 a.a. - 191 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 38
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 95% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, pH 7.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7422
  • Gene Name:
  • VEGFA
  • Gene Alias:
  • MGC70609,VEGF,VEGF-A,VPF
  • Gene Description:
  • vascular endothelial growth factor A
  • Gene Summary:
  • This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq
  • Other Designations:
  • vascular endothelial growth factor isoform VEGF165,vascular permeability factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook