Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSLP (Human) Recombinant ProteinBioActive

  • Catalog # : P3671
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TSLP (Q969D9, 29 a.a. - 159 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of human IL-7R-alpha and human TSLP R co-transfected mouse BaF3 cells, was found to be <3.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 150mM NaCl, pH 7.4
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • TSLP
  • Gene Alias:
  • -
  • Gene Description:
  • thymic stromal lymphopoietin
  • Gene Summary:
  • This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook