Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL5 (Human) Recombinant ProteinBioActive

  • Catalog # : P3664
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human blood monocytes using a concentration range of 1.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6352
  • Gene Name:
  • CCL5
  • Gene Alias:
  • D17S136E,MGC17164,RANTES,SCYA5,SISd,TCP228
  • Gene Description:
  • chemokine (C-C motif) ligand 5
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. [provided by RefSeq
  • Other Designations:
  • SIS-delta,T-cell specific RANTES protein,T-cell specific protein p288,beta-chemokine RANTES,regulated upon activation, normally T-expressed, and presumably secreted,small inducible cytokine A5,small inducible cytokine A5 (RANTES),small inducible cytokine
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook