Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRG1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3658
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NRG1 (Q02297, 177 a.a. - 237 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of human MCF-7 cells was found to be <0.3 ng/mL, corresponding to a specific activity of 2 x 106 units/mg.
  • Storage Buffer:
  • Lyophilized from 10 mM PB, pH 7.0 (2% mannitol, 0.5% HAS)
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3084
  • Gene Name:
  • NRG1
  • Gene Alias:
  • ARIA,GGF,GGF2,HGL,HRG,HRG1,HRGA,NDF,SMDF
  • Gene Description:
  • neuregulin 1
  • Gene Summary:
  • The protein encoded by this gene was originally identified as a 44-kD glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. This protein is a signaling protein that mediates cell-cell interactions and plays critical roles in the growth and development of multiple organ systems. It is known that an extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are tissue-specifically expressed and differ significantly in their structure, and thereby these isoforms are classified into types I, II, III, IV, V and VI. The gene dysregulation has been linked to diseases such as cancer, schizophrenia and bipolar disorder (BPD). [provided by RefSeq
  • Other Designations:
  • glial growth factor,heregulin, alpha (45kD, ERBB2 p185-activator),neu differentiation factor,neuregulin 1 isoform HRG-gamma,sensory and motor neuron derived factor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook