Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPBP (Human) Recombinant ProteinBioActive

  • Catalog # : P3656
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPBP (P02775, 59 a.a. - 128 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5473
  • Gene Name:
  • PPBP
  • Gene Alias:
  • B-TG1,Beta-TG,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,MDGF,NAP-2,PBP,SCYB7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
  • Gene Description:
  • pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
  • Gene Summary:
  • The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and sythesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. [provided by RefSeq
  • Other Designations:
  • CXC chemokine ligand 7,beta-thromboglobulin,connective tissue-activating peptide III,leukocyte-derived growth factor,low-affinity platelet factor IV,macrophage-derived growth factor,neutrophil-activating peptide 2,neutrophil-activating peptide-2,platelet
  • RSS
  • YouTube
  • Linkedin
  • Facebook