Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL4 (Human) Recombinant ProteinBioActive

  • Catalog # : P3652
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL4 (P13236, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human blood monocytes using a concentration range of 2.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6351
  • Gene Name:
  • CCL4
  • Gene Alias:
  • ACT2,AT744.1,G-26,LAG1,MGC104418,MGC126025,MGC126026,MIP-1-beta,MIP1B,MIP1B1,SCYA2,SCYA4
  • Gene Description:
  • chemokine (C-C motif) ligand 4
  • Other Designations:
  • CC chemokine ligand 4,chemokine C-C motif ligand 4,lymphocyte-activation gene 1,secreted protein G-26,small inducible cytokine A4 (homologous to mouse Mip-1b)
  • RSS
  • YouTube
  • Linkedin
  • Facebook