Product Browser

Last updated: 2014/11/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL3 (Human) Recombinant ProteinBioActive

  • Catalog # : P3651
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 98% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6348
  • Gene Name:
  • CCL3
  • Gene Alias:
  • G0S19-1,LD78ALPHA,MIP-1-alpha,MIP1A,SCYA3
  • Gene Description:
  • chemokine (C-C motif) ligand 3
  • Gene Summary:
  • Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988 [PubMed 3279154]). Sherry et al. (1988) [PubMed 3058856] demonstrated 2 protein components of MIP1, called by them alpha and beta.[supplied by OMIM
  • Other Designations:
  • LD78 alpha beta,small inducible cytokine A3 (homologous to mouse Mip-1a)
  • RSS
  • YouTube
  • Linkedin
  • Facebook