Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIF (Human) Recombinant ProteinBioActive

  • Catalog # : P3646
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LIF (P15018, 23 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent differentiation of M1 myeloid leukemic cells was found to be in the range of 0.01 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 4.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3976
  • Gene Name:
  • LIF
  • Gene Alias:
  • CDF,DIA,HILDA
  • Gene Description:
  • leukemia inhibitory factor (cholinergic differentiation factor)
  • Gene Summary:
  • The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. [provided by RefSeq
  • Other Designations:
  • D factor,cholinergic differentiation factor,differentiation inhibitory activity,differentiation stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook