Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF7 (Human) Recombinant ProteinBioActive

  • Catalog # : P3645
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF7 (P21781, 32 a.a. - 194 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of BAF3 cells was found to be less than 10 ng/mL.
  • Storage Buffer:
  • Lyophilized from 1M NaCl, 20mM PB, pH 8.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2252
  • Gene Name:
  • FGF7
  • Gene Alias:
  • HBGF-7,KGF
  • Gene Description:
  • fibroblast growth factor 7 (keratinocyte growth factor)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq
  • Other Designations:
  • fibroblast growth factor 7,heparin-binding growth factor 7,keratinocyte growth factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook