Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL11 (Human) Recombinant ProteinBioActive

  • Catalog # : P3644
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human T cells using a concentration range of 2.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 100 M NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6373
  • Gene Name:
  • CXCL11
  • Gene Alias:
  • H174,I-TAC,IP-9,IP9,MGC102770,SCYB11,SCYB9B,b-R1
  • Gene Description:
  • chemokine (C-X-C motif) ligand 11
  • Gene Summary:
  • Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq
  • Other Designations:
  • small inducible cytokine B11,small inducible cytokine subfamily B (Cys-X-Cys), member 11,small inducible cytokine subfamily B (Cys-X-Cys), member 9B
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook