Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL29 (Human) Recombinant ProteinBioActive

  • Catalog # : P3635
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL29
  • Gene Alias:
  • IFNL1,IL-29
  • Gene Description:
  • interleukin 29 (interferon, lambda 1)
  • Gene Summary:
  • This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq
  • Other Designations:
  • interferon, lambda 1,interleukin 29
  • RSS
  • YouTube
  • Linkedin
  • Facebook