IL29 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Host
Escherichia coli
Theoretical MW (kDa)
20
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purification
Ion exchange column and HPLC reverse phase column
Purity
> 90% by SDS-PAGE and HPLC
Endotoxin Level
< 0.1 ng/ug (1 EU/ug)
Activity
The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5 ng/mL.
Storage Buffer
Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5
Storage Instruction
Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — IL29
Entrez GeneID
282618Protein Accession#
Q8IU54Gene Name
IL29
Gene Alias
IFNL1, IL-29
Gene Description
interleukin 29 (interferon, lambda 1)
Omim ID
607403Gene Ontology
HyperlinkGene Summary
This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq
Other Designations
interferon, lambda 1|interleukin 29
-
Interactome
-
Pathway
-
Publication Reference
-
IRF-1, RIG-I and MDA5 display potent antiviral activities against norovirus coordinately induced by different types of interferons.
Dang W, Xu L, Yin Y, Chen S, Wang W, Hakim MS, Chang KO, Peppelenbosch MP, Pan Q.
Antiviral Research 2018 Jul; 155:48.
Application：Func, Human, HG23 cells.
-
IRF-1, RIG-I and MDA5 display potent antiviral activities against norovirus coordinately induced by different types of interferons.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com