Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL12B (Human) Recombinant ProteinBioActive

  • Catalog # : P3629
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL12B (P29460, 23 a.a. - 529 a.a.) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 75
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation of activated human T lymphoblasts. cells was found to be in the range of 0.1-0.2 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3593
  • Gene Name:
  • IL12B
  • Gene Alias:
  • CLMF,CLMF2,IL-12B,NKSF,NKSF2
  • Gene Description:
  • interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
  • Gene Summary:
  • This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq
  • Other Designations:
  • IL12, subunit p40,OTTHUMP00000160820,cytotoxic lymphocyte maturation factor 2, p40,interleukin 12, p40,interleukin 12B,interleukin-12 beta chain,natural killer cell stimulatory factor, 40 kD subunit,natural killer cell stimulatory factor-2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook