Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNB1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3623
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNB1 (P01574, 22 a.a. - 187 a.a.) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 19
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The activity was determined by the viral resistance assay of Human WISH cells was found to be in the range of 3 x 108 IU/mg.
  • Storage Buffer:
  • Lyophilized from sodium acetate solution pH 4.8
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3456
  • Gene Name:
  • IFNB1
  • Gene Alias:
  • IFB,IFF,IFNB,MGC96956
  • Gene Description:
  • interferon, beta 1, fibroblast
  • Other Designations:
  • OTTHUMP00000021131,interferon beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook