Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL16 (Human) Recombinant ProteinBioActive

  • Catalog # : P3620
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL16 (O15467, 24 a.a. - 120 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 11
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6360
  • Gene Name:
  • CCL16
  • Gene Alias:
  • CKb12,HCC-4,ILINCK,LCC-1,LEC,LMC,MGC117051,Mtn-1,NCC-4,NCC4,SCYA16,SCYL4
  • Gene Description:
  • chemokine (C-C motif) ligand 16
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq
  • Other Designations:
  • IL-10-inducible chemokine,chemokine CC-4,chemokine LEC,liver CC chemokine-1,liver-expressed chemokine,lymphocyte and monocyte chemoattractant,monotactin-1,new CC chemokine 4,small inducible cytokine A16,small inducible cytokine subfamily A (Cys-Cys), memb
  • RSS
  • YouTube
  • Linkedin
  • Facebook