Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSTN (Human) Recombinant ProteinBioActive

  • Catalog # : P3612
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSTN (O14793, 267 a.a. - 375 a.a.) partial recombinant protein. expressed in Escherichia coli.
  • Sequence:
  • DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25 (non-reducing)
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by the dose-dependent proliferation inhibition of human MPC-11 cells was found to be in the range of 20.0-40.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from Tris, pH 8.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2660
  • Gene Name:
  • MSTN
  • Gene Alias:
  • GDF8
  • Gene Description:
  • myostatin
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth. [provided by RefSeq
  • Other Designations:
  • growth differentiation factor 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook