Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL21 (Human) Recombinant ProteinBioActive

  • Catalog # : P3606
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL21 (O00585, 1 a.a. - 134 a.a.) full-length recombinant protein. expressed in Escherichia coli.
  • Sequence:
  • MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract total lymphocyte population using a concentration range of 10.0-100.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6366
  • Gene Name:
  • CCL21
  • Gene Alias:
  • 6Ckine,CKb9,ECL,MGC34555,SCYA21,SLC,TCA4
  • Gene Description:
  • chemokine (C-C motif) ligand 21
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq
  • Other Designations:
  • Efficient Chemoattractant for Lymphocytes,OTTHUMP00000000526,OTTHUMP00000000527,OTTHUMP00000021304,beta chemokine exodus-2,exodus-2,secondary lymphoid tissue chemokine,small inducible cytokine A21,small inducible cytokine subfamily A (Cys-Cys), member 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook