Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPO (Human) Recombinant ProteinBioActive

  • Catalog # : P3605
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EPO (P01588, 28 a.a. - 193 a.a.) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 35
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Activity was determined by the dose-dependent proliferation assay using a factor-dependent human erythroleukemic cell line TF-1 and was found to be 3.8 x 105 IU/mg.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2056
  • Gene Name:
  • EPO
  • Gene Alias:
  • EP,MGC138142
  • Gene Description:
  • erythropoietin
  • Gene Summary:
  • This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq
  • Other Designations:
  • epoetin
  • RSS
  • YouTube
  • Linkedin
  • Facebook