Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL24 (Human) Recombinant ProteinBioActive

  • Catalog # : P3604
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL24 (O00175, 1 a.a. - 119 a.a.) full-length recombinant protein. expressed in Escherichia coli.
  • Sequence:
  • MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • Activity was determined by the ability to induce chemotaxis of purified eosinophils at concentrations ranging between 50-100 ng/mL.
  • Storage Buffer:
  • Lyophilzed from 100 mM NaCl, 10 mM PB, pH 7.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6369
  • Gene Name:
  • CCL24
  • Gene Alias:
  • Ckb-6,MPIF-2,MPIF2,SCYA24
  • Gene Description:
  • chemokine (C-C motif) ligand 24
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq
  • Other Designations:
  • CK-beta-6,eotaxin-2,myeloid progenitor inhibitory factor 2,small inducible cytokine A24,small inducible cytokine subfamily A (Cys-Cys), member 24
  • RSS
  • YouTube
  • Linkedin
  • Facebook