Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEFB1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3591
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DEFB1 (P60022, 33 a.a. - 70 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Activity:
  • The ED50 was determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0 ug/mL.
  • Storage Buffer:
  • Lyophilized from 100 mM NaCl, 20 mM PB, pH 7.4
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1672
  • Gene Name:
  • DEFB1
  • Gene Alias:
  • BD1,DEFB-1,DEFB101,HBD1,MGC51822
  • Gene Description:
  • defensin, beta 1
  • Gene Summary:
  • Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq
  • Other Designations:
  • beta-defensin-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook