Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSRB2 (Human) Recombinant Protein

  • Catalog # : P3560
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSRB2 (NP_036360, 21 a.a. - 182 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3560
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1 mM PMSF, pH 7.5 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • MSRB2
  • Gene Alias:
  • CBS-1,CBS1,CGI-131,MGC26104,MSRB,PILB
  • Gene Description:
  • methionine sulfoxide reductase B2
  • Other Designations:
  • OTTHUMP00000019305,methionine-r-sulfoxide reductase B2 variant 1,methionine-r-sulfoxide reductase B2 variant 3,pilin-like transcription factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook