Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UPP1 (Human) Recombinant Protein

  • Catalog # : P3558
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UPP1 (NP_853628, 1 a.a. - 310 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 36
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3558
  • Storage Buffer:
  • In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (1 mM dithiothreitol, 40% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7378
  • Gene Name:
  • UPP1
  • Gene Alias:
  • UDRPASE,UP,UPASE,UPP
  • Gene Description:
  • uridine phosphorylase 1
  • Gene Summary:
  • The 2 known types of pyrimidine nucleoside phosphorylases, uridine phosphorylase (UP; EC 2.4.2.3) and thymidine phosphorylase (TP; EC 2.4.2.4), in the presence of orthophosphate, catalyze the reversible phosphorolysis of uridine and thymidine or deoxyuridine, respectively, to free bases and ribose-1-phosphate or deoxyribose-1-phosphate. Pyrimidine nucleoside phosphorylases can add ribose or deoxyribose to pyrimidine bases to form nucleosides that can be incorporated into RNA or DNA (Watanabe and Uchida, 1995 [PubMed 7488099]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000159566
  • RSS
  • YouTube
  • Linkedin
  • Facebook