Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FHIT (Human) Recombinant Protein

  • Catalog # : P3552
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FHIT (NP_002003, 1 a.a. - 147 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQLEHHHHHH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3552
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2272
  • Gene Name:
  • FHIT
  • Gene Alias:
  • AP3Aase,FRA3B
  • Gene Description:
  • fragile histidine triad gene
  • Gene Summary:
  • This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq
  • Other Designations:
  • AP3A hydrolase,bis(5'-adenosyl)-triphosphatase,diadenosine 5',5'''-P1,P3-triphosphate hydrolase,dinucleosidetriphosphatase,tumor suppressor protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook