Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB27A (Human) Recombinant Protein

  • Catalog # : P3551
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAB27A (NP_899059, 1 a.a. - 221 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3551
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5873
  • Gene Name:
  • RAB27A
  • Gene Alias:
  • GS2,HsT18676,MGC117246,RAB27,RAM
  • Gene Description:
  • RAB27A, member RAS oncogene family
  • Gene Summary:
  • The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • GTP-binding protein Ram,Ras-related protein Rab-27A
  • RSS
  • YouTube
  • Linkedin
  • Facebook