Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS9 (Human) Recombinant Protein

  • Catalog # : P3548
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LGALS9 (NP_033665, 1 a.a. - 148 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3548
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3965
  • Gene Name:
  • LGALS9
  • Gene Alias:
  • HUAT,LGALS9A,MGC117375,MGC125973,MGC125974
  • Gene Description:
  • lectin, galactoside-binding, soluble, 9
  • Gene Summary:
  • The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ecalectin,galectin 9,galectin-9,urate transporter/channel protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook