Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FDX1 (Human) Recombinant Protein

  • Catalog # : P3539
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FDX1 (NP_004100, 61 a.a. - 184 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3539
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH8.0 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2230
  • Gene Name:
  • FDX1
  • Gene Alias:
  • ADX,FDX,LOH11CR1D
  • Gene Description:
  • ferredoxin 1
  • Gene Summary:
  • The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq
  • Other Designations:
  • adrenodoxin
  • RSS
  • YouTube
  • Linkedin
  • Facebook