Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

XCL1 (Human) Recombinant Protein

  • Catalog # : P3536
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human XCL1 (NP_002986, 22 a.a. - 114 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3536
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.2 M NaCl, pH 8.0 (2 mM dithiothreitol, 30% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6375
  • Gene Name:
  • XCL1
  • Gene Alias:
  • ATAC,LPTN,LTN,SCM-1,SCM-1a,SCM1,SCYC1
  • Gene Description:
  • chemokine (C motif) ligand 1
  • Other Designations:
  • OTTHUMP00000032498,OTTHUMP00000060404,lymphotactin,small inducible cytokine subfamily C, member 1 (lymphotactin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook