Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VAMP5 (Human) Recombinant Protein

  • Catalog # : P3530
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human VAMP5 (NP_006625, 1 a.a. - 72 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRIC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12.7
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3530
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (2 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • VAMP5
  • Gene Alias:
  • -
  • Gene Description:
  • vesicle-associated membrane protein 5 (myobrevin)
  • Gene Summary:
  • Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq
  • Other Designations:
  • myobrevin,vesicle-associated membrane protein 5
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook