Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDK1 (Human) Recombinant Protein

  • Catalog # : P3527
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDK1 (NP_002601, 29 a.a. - 436 a.a.) partial recombinant protein expressed in Escherichia coli. , 29 a.a. - 436 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 48.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3527
  • Storage Buffer:
  • In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, 0.1 mM PMSF, 1 mM MgCl2, pH 7.0 (0.5 mM dithiothreitol, 40% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5163
  • Gene Name:
  • PDK1
  • Gene Alias:
  • -
  • Gene Description:
  • pyruvate dehydrogenase kinase, isozyme 1
  • Gene Summary:
  • Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. [provided by RefSeq
  • Other Designations:
  • mitochondrial pyruvate dehydrogenase kinase isoenzyme 1,pyruvate dehydrogenase kinase, isoenzyme 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook