Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HTRA2 (Human) Recombinant Protein

  • Catalog # : P3519
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HTRA2 (NP_037379, 134 a.a. - 458 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MAVPSPPPASPPSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEGSHHHHHH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 36
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3519
  • Storage Buffer:
  • In 20 mM Tris-HCl, 50 mM NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • HTRA2
  • Gene Alias:
  • OMI,PARK13,PRSS25
  • Gene Description:
  • HtrA serine peptidase 2
  • Gene Summary:
  • This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • HtrA-like serine protease,Omi stress-regulated endoprotease,high temperature requirement protein A2,protease, serine, 25
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook