Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTA (Human) Recombinant ProteinBioActive

  • Catalog # : P3506
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LTA (NP_001153212, 35 a.a. - 205 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Measured in a cytotoxicity assay using L929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is <0.3 ng/mL.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3506
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 30% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4049
  • Gene Name:
  • LTA
  • Gene Alias:
  • LT,TNFB,TNFSF1
  • Gene Description:
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Gene Summary:
  • The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
  • Other Designations:
  • OTTHUMP00000029184,OTTHUMP00000037612,OTTHUMP00000037613,OTTHUMP00000165897,lymphotoxin alpha,tumor necrosis factor beta
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook