Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1C1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3501
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKR1C1 (NP_001344, 1 a.a. - 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 38.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity: approximately 0.15-0.2 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 umole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3501
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1645
  • Gene Name:
  • AKR1C1
  • Gene Alias:
  • 2-ALPHA-HSD,20-ALPHA-HSD,C9,DD1,DDH,DDH1,H-37,HAKRC,MBAB,MGC8954
  • Gene Description:
  • aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
  • Other Designations:
  • 20 alpha-hydroxysteroid dehydrogenase,OTTHUMP00000018992,aldo-keto reductase C,aldo-keto reductase family 1, member C1,chlordecone reductase homolog,dihydrodiol dehydrogenase 1,dihydrodiol dehydrogenase isoform DD1,hepatic dihydrodiol dehydrogenase,trans-
  • RSS
  • YouTube
  • Linkedin
  • Facebook