Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKBP3 (Human) Recombinant ProteinBioActive

  • Catalog # : P3500
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FKBP3 (NP_002004, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity is > 490 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3500
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2287
  • Gene Name:
  • FKBP3
  • Gene Alias:
  • FKBP-25,PPIase
  • Gene Description:
  • FK506 binding protein 3, 25kDa
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
  • Other Designations:
  • FK506 binding protein 3 (25kD),FK506-binding protein 25, T-cell,FK506-binding protein 3 (25kD),peptidyl-prolyl cis-trans isomerase,rapamycin binding protein,rapamycin-selective 25 kDa immunophilin,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook