Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR7A2 (Human) Recombinant ProteinBioActive

  • Catalog # : P3498
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKR7A2 (NP_003680, 1 a.a. - 359 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 44
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity: approximately 0.25-0.3 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 umole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3498
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8574
  • Gene Name:
  • AKR7A2
  • Gene Alias:
  • AFAR,AFAR1,AFB1-AR1,AKR7
  • Gene Description:
  • aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
  • Gene Summary:
  • Aldo-keto reductases, such as AKR7A2, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM
  • Other Designations:
  • aflatoxin beta1 aldehyde reductase,aldo-keto reductase family 7, member A2,aldoketoreductase 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook