Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDRG1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3493
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCLEHHHHHH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 43.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 for this effect is 0.5 - 1.5 ng/mL. Measured in a cell proliferation assay using MCF7 cell.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3493
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1 mM PMSF, pH 8.0 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • NDRG1
  • Gene Alias:
  • CAP43,CMT4D,DRG1,GC4,HMSNL,NDR1,NMSL,PROXY1,RIT42,RTP,TARG1,TDD5
  • Gene Description:
  • N-myc downstream regulated 1
  • Gene Summary:
  • This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • differentiation-related gene 1 protein,nickel-specific induction protein Cap43,protein regulated by oxygen-1,reducing agents and tunicamycin-responsive protein,tunicamycin-responsive protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook