Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKBP1A (Human) Recombinant ProteinBioActive

  • Catalog # : P3484
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FKBP1A (NP_463460, 1 a.a. - 108 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 14.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • Specific activity is > 300 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3484
  • Storage Buffer:
  • In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2280
  • Gene Name:
  • FKBP1A
  • Gene Alias:
  • FKBP-12,FKBP1,FKBP12,FKBP12C,PKC12,PKCI2,PPIASE
  • Gene Description:
  • FK506 binding protein 1A, 12kDa
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq
  • Other Designations:
  • FK506-binding protein 1,FK506-binding protein 12,FK506-binding protein 1A (12kD),FK506-binding protein, T-cell, 12-kD,OTTHUMP00000029978,immunophilin FKBP12,peptidyl-prolyl cis-trans isomerase,protein kinase C inhibitor 2,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook