Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDX2 (Human) Recombinant ProteinBioActive

  • Catalog # : P3480
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRDX2 (NP_005800, 1 a.a. - 198 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21.8
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity: approximately 200-230 pmole/min/ug. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3480
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7001
  • Gene Name:
  • PRDX2
  • Gene Alias:
  • MGC4104,NKEFB,PRP,PRX2,PRXII,TDPX1,TSA
  • Gene Description:
  • peroxiredoxin 2
  • Gene Summary:
  • This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • natural killer-enhancing factor B,thiol-specific antioxidant 1,thioredoxin peroxidase 1,thioredoxin-dependent peroxide reductase 1,torin
  • RSS
  • YouTube
  • Linkedin
  • Facebook