Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLO1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3478
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GLO1 (NP_006699, 1 a.a. - 184 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.7
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity: >0.4 units/mg (please enquire for specific batch value). One unit will form 1.0 umol of S-lactoylglutathione from methylglyoxal and reduced glutathione per minute at pH 7.5, at 25°C. Specific activity was expressed in units/mg of
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3478
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2739
  • Gene Name:
  • GLO1
  • Gene Alias:
  • GLOD1,GLYI
  • Gene Description:
  • glyoxalase I
  • Gene Summary:
  • The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016339,glyoxalase domain containing 1,lactoyl glutathione lyase,lactoylglutathione lyase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook