Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIL1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3473
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIL1 (NP_057143, 1 a.a. - 166 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGLEHHHHHH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is > 300 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3473
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PPIL1
  • Gene Alias:
  • CGI-124,CYPL1,MGC678,PPIase,hCyPX
  • Gene Description:
  • peptidylprolyl isomerase (cyclophilin)-like 1
  • Gene Summary:
  • This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016310,cyclophilin-related gene 1,peptidyl-prolyl cis-trans isomerase,peptidylprolyl isomerase-like 1,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook