Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIH (Human) Recombinant ProteinBioActive

  • Catalog # : P3468
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIH (NP_006338, 1 a.a. - 177 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • Specific activity is > 220 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3468
  • Storage Buffer:
  • In PBS, pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PPIH
  • Gene Alias:
  • CYP-20,CYPH,MGC5016,SnuCyp-20,USA-CYP
  • Gene Description:
  • peptidylprolyl isomerase H (cyclophilin H)
  • Gene Summary:
  • The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008725,PPIase h,U-snRNP-associated cyclophilin SunCyp-20,USA-CyP SnuCyp-20,cyclophilin H,peptidyl-prolyl cis-trans isomerase H,peptidylprolyl isomerase H,rotamase H,small nuclear ribonucleoprotein particle-specific cyclophilin H
  • RSS
  • YouTube
  • Linkedin
  • Facebook