Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDX1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3465
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRDX1 (NP_002565, 1 a.a. - 199 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • Specific activity is > 2,000 pmol/min/ug. Enzymatic activity is defined as the amount of hydroperoxide that 1ug of enzyme can reduce at 25°C for minute.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3465
  • Storage Buffer:
  • In 20 mM Tris, pH 7.5 (20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5052
  • Gene Name:
  • PRDX1
  • Gene Alias:
  • MSP23,NKEFA,PAG,PAGA,PAGB,PRX1,PRXI,TDPX2
  • Gene Description:
  • peroxiredoxin 1
  • Gene Summary:
  • This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000009234,natural killer-enhancing factor A,proliferation-associated gene A,thioredoxin-dependent peroxide reductase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook