Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL3 (Human) Recombinant ProteinBioActive

  • Catalog # : P3461
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL3 (AAC08706, 20 aa. - 152 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • The ED50 for this effect is <0.53 ng/mL. Measured in a cell proliferation assay using TF1 human erythroleukemic cells.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3461
  • Storage Buffer:
  • In 20 mM Tris, 0.2 mM PMSF, pH 8.0 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3562
  • Gene Name:
  • IL3
  • Gene Alias:
  • IL-3,MCGF,MGC79398,MGC79399,MULTI-CSF
  • Gene Description:
  • interleukin 3 (colony-stimulating factor, multiple)
  • Gene Summary:
  • The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq
  • Other Designations:
  • P-cell stimulating factor,hematopoietic growth factor,interleukin 3,mast-cell growth factor,multilineage-colony-stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook