Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIA (Human) Recombinant ProteinBioActive

  • Catalog # : P3460
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIA (NP_066953, 1 a.a. - 165 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • Specific activity is > 270 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3460
  • Storage Buffer:
  • In 20 mM Tris, 20 mM NaCl, pH 8.0 (0.5 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5478
  • Gene Name:
  • PPIA
  • Gene Alias:
  • CYPA,CYPH,MGC117158,MGC12404,MGC23397
  • Gene Description:
  • peptidylprolyl isomerase A (cyclophilin A)
  • Gene Summary:
  • This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025305,PPIase A,T cell cyclophilin,cyclosporin A-binding protein,peptidyl-prolyl cis-trans isomerase A,peptidylprolyl isomerase A,rotamase A
  • RSS
  • YouTube
  • Linkedin
  • Facebook