Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3456
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF1 (NP_000791, 16 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 for this effect is < 2.9 ng/mL, measured in a cell proliferation assay using NIH-3T3 cell (which corresponds to > 340,000 units/mL).
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3456
  • Storage Buffer:
  • In 20 mM Tris, 100 mM NaCl, pH 7.0
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2246
  • Gene Name:
  • FGF1
  • Gene Alias:
  • AFGF,ECGF,ECGF-beta,ECGFA,ECGFB,FGF-alpha,FGFA,GLIO703,HBGF1
  • Gene Description:
  • fibroblast growth factor 1 (acidic)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000066028,OTTHUMP00000066030,OTTHUMP00000066031,OTTHUMP00000174675,endothelial cell growth factor, alpha,endothelial cell growth factor, beta,heparin-binding growth factor 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook