Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TXN (Human) Recombinant ProteinBioActive

  • Catalog # : P3454
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 11.7
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is 7-10 A650/min/mg, obtained by measuring the increase of insulin precipitation in absorbance at 650 nm resulting from the reduction of insulin. Please refer to our activity assay protocol.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3454
  • Storage Buffer:
  • In PBS, pH 7.4
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7295
  • Gene Name:
  • TXN
  • Gene Alias:
  • DKFZp686B1993,MGC61975,TRX,TRX1
  • Gene Description:
  • thioredoxin
  • Gene Summary:
  • Thioredoxin is a 12-kD oxidoreductase enzyme containing a dithiol-disulfide active site. It is ubiquitous and found in many organisms from plants and bacteria to mammals. Multiple in vitro substrates for thioredoxin have been identified, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin. Reduction of insulin is classically used as an activity test.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000021892
  • RSS
  • YouTube
  • Linkedin
  • Facebook