Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3452
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF1 (NP_000609, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 for this effect is < 3.6 ng/mL. Measured in a cell proliferation assay using MCF7 cell.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3452
  • Storage Buffer:
  • In PBS, pH 7.4
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3479
  • Gene Name:
  • IGF1
  • Gene Alias:
  • IGFI
  • Gene Description:
  • insulin-like growth factor 1 (somatomedin C)
  • Gene Summary:
  • The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • insulin-like growth factor 1,somatomedin C
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook