Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIN1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3447
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIN1 (NP_006212, 1 a.a. - 163 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • Specific activity is > 330 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Quality Control Testing:
  • Loading 3 ug protein in 14% SDS-PAGE

    QC Testing of P3447
  • Storage Buffer:
  • In 20 mM Tris-HCl buffer(pH 7.5) 0.1M NaCl, 5 mM dithiothreitol, 20%glycerol.
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5300
  • Gene Name:
  • PIN1
  • Gene Alias:
  • DOD,UBL5
  • Gene Description:
  • peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  • Gene Summary:
  • The human PIN1 gene encodes an essential nuclear peptidylprolyl cis-trans isomerase (PPIase; EC 5.2.1.8) involved in regulation of mitosis. PIN1 belongs to a class of PPIases that includes the E. coli parvulin, yeast Ess1, and Drosophila dodo (dod) gene products (Lu et al., 1996 [PubMed 8606777]).[supplied by OMIM
  • Other Designations:
  • peptidyl-prolyl cis/trans isomerase, NIMA-interacting,prolyl isomerase,protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1,protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook