Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTPN1 (Human) Recombinant ProteinBioActive

  • Catalog # : P3444
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 37.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity: 6,000-12,000 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37°C, pH7.5 using 10mM of substrate.
  • Quality Control Testing:
  • Loading 3 ug protein in 12% SDS-PAGE

    QC Testing of P3444
  • Storage Buffer:
  • In 25 mM Tris-HCl, 1 mM EDTA, pH 7.5 (2 mM beta-mercaptoethanol, 1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5770
  • Gene Name:
  • PTPN1
  • Gene Alias:
  • PTP1B
  • Gene Description:
  • protein tyrosine phosphatase, non-receptor type 1
  • Gene Summary:
  • The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031266,non-receptor tyrosine phosphatase 1,protein tyrosine phosphatase 1B,protein tyrosine phosphatase, placental
  • RSS
  • YouTube
  • Linkedin
  • Facebook