Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT2A1 (Human) Recombinant Protein

  • Catalog # : P3441
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SULT2A1 (NP_003158, 1 a.a. - 285 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 35.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3441
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6822
  • Gene Name:
  • SULT2A1
  • Gene Alias:
  • DHEA-ST,DHEAS,HST,ST2,ST2A3,STD,hSTa
  • Gene Description:
  • sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene is primarily expressed in liver and adrenal tissues where the encoded protein sulfates steroids and bile acids. [provided by RefSeq
  • Other Designations:
  • alcohol sulfotransferase,alcohol/hydroxysteroid sulfotransferase,dehydroepiandrosterone sulfotransferase,hydroxysteroid sulfotransferase,sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1,sulfotransferase family, cytosolic, 2A,
  • RSS
  • YouTube
  • Linkedin
  • Facebook