Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP1LC3B2 (Human) Recombinant Protein

  • Catalog # : P3434
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MAP1LC3B2 (NP_001078950, 1 a.a. - 120 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3434
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • MAP1LC3B2
  • Gene Alias:
  • -
  • Gene Description:
  • microtubule-associated protein 1 light chain 3 beta 2
  • Other Designations:
  • Microtubule-associated proteins 1A/1B light chain 3B-like protein,microtubule-associated protein 1 light chain 3 beta-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook