Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFAM (Human) Recombinant Protein

  • Catalog # : P3421
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TFAM (NP_003192, 43 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.25 mg/mL
  • Purity:
  • > 85% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3421
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.2M NaCl, pH 8.0 (5 mM dithiothreitol, 20% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7019
  • Gene Name:
  • TFAM
  • Gene Alias:
  • MtTF1,TCF6,TCF6L1,TCF6L2,TCF6L3,mtTFA
  • Gene Description:
  • transcription factor A, mitochondrial
  • Gene Summary:
  • This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019633,Transcription factor 6-like 2 (mitochondrial transcription factor),mitochondrial transcription factor A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook